DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and hoxc6a

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio


Alignment Length:59 Identity:25/59 - (42%)
Similarity:38/59 - (64%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 KRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRD 411
            :|:.|..::.:|..||||.|.:.:||:...|.|||.:|.|:..|:..||||||.|.|::
Zfish   142 RRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649 24/55 (44%)
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128
Homeodomain 143..199 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.