DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Pdx1

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_074043.4 Gene:Pdx1 / 29535 RGDID:62387 Length:283 Species:Rattus norvegicus


Alignment Length:130 Identity:40/130 - (30%)
Similarity:64/130 - (49%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 QPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIE 413
            :|::.:::|||:|..|:.||||.||:.||:|...|.|:|..|.|:...:..||||||.|.|:: |
  Rat   142 EPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE-E 205

  Fly   414 ELKKDFDSVKVFSAHKSFLENVNDLSILKKKPMHESDMVGLAAAAAAAGMVVPVPGSVPMGGAPP 478
            :.|:...:......              .::|  |.|     .|..:...::.:|...|.|||.|
  Rat   206 DKKRSSGTTSGGGG--------------GEEP--EQD-----CAVTSGEELLALPPPPPPGGAVP 249

  Fly   479  478
              Rat   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649 26/55 (47%)
Pdx1NP_074043.4 Transactivation domain 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..81
Antp-type hexapeptide 118..123
Homeodomain 147..203 CDD:459649 26/55 (47%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 13/71 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.