DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Dbx1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001009644.1 Gene:Dbx1 / 292934 RGDID:1308896 Length:335 Species:Rattus norvegicus


Alignment Length:350 Identity:85/350 - (24%)
Similarity:127/350 - (36%) Gaps:71/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LLAPPASRPIAPSGGLLQPRTEPLDVHPAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSALLH 223
            ||||||..|     .||:| |..|.:..:..:|....|..:|.....:..|...:...||:|.|.
  Rat     6 LLAPPAGYP-----SLLRP-TPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPTYLPRSIPTASLS 64

  Fly   224 YEQRLALDYHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQA-EK 287
            ..::.|                        |..:|....|...|..|.|..||    ||:.| ..
  Rat    65 PPRQEA------------------------PTALADSGTSDLGSPGSGSRRGS----SPQTALSP 101

  Fly   288 LEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSN------ 346
            ..:.|..:....|....:..:.|.........|....|......|......|:....|:      
  Rat   102 ASEPTFLKFGVNAILSSAPRRETSPALLQSPPPKTFAFPYFEGSFQPFIRSSYFPASSSVVPIPG 166

  Fly   347 --------RPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQN 403
                    |.:|::....|..|::.|...|||.|..|||:|..||.::|:.|||.::||..||||
  Rat   167 TFSWPLAARGKPRRGMLRRAVFSDVQRKALEKTFQKQKYISKPDRKKLASKLGLKDSQVKIWFQN 231

  Fly   404 RRAKQKRDIEELKKDFDSVKVFSA----HKSFLENVN---DLSILKKKPM--HESDMVGLAAAAA 459
            ||.|.:...|.        ::.|:    .::....:|   |||.:.:|..  .|.|..|.:.|..
  Rat   232 RRMKWRNSKER--------ELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGDEEEDSPGASLAYH 288

  Fly   460 AAG-----MVVPVPGSVPMGGAPPK 479
            |..     :..|:|.|.....:|.|
  Rat   289 APPDPRHLLEGPLPASPAHSSSPGK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 26/53 (49%)
Dbx1NP_001009644.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..102 16/73 (22%)
Homeobox 184..237 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..335 16/81 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.