DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and tlx3b

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_739572.1 Gene:tlx3b / 266965 ZFINID:ZDB-GENE-021021-1 Length:300 Species:Danio rerio


Alignment Length:275 Identity:65/275 - (23%)
Similarity:107/275 - (38%) Gaps:91/275 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 SSSSNGSTECCSPRQAEKL-----EKLT-TQEGSEEAQKKKSEEQPTGSGKSNGD---------- 318
            |||.:|:::...|.|.|.:     :.|: |.:.|::...:.|.|..:||..::|.          
Zfish     6 SSSPSGTSQTSQPTQHEPISFGIDQILSGTDQESQQNSTRNSSESSSGSSSASGGCYHLGSPTGA 70

  Fly   319 -----TPLDALFQMTTKDFDESQD---------------KSHLDI-------------------- 343
                 |.|...|......::||..               .:|..:                    
Zfish    71 SATPYTTLTGTFHGIAAPYEESSPYGVNLTLAPGGVIRVPAHRPLAAAVPPPMASAVPGLGSLSF 135

  Fly   344 ------------------------------FSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYL 378
                                          :.||..||:| |.||:|:..||.||||||..||||
Zfish   136 PWMESSQRFAKDRFAAALTPFTVARRIGHPYQNRTPPKRK-KPRTSFSRVQICELEKRFHRQKYL 199

  Fly   379 SPADRDEIAASLGLSNAQVITWFQNRRAKQKR----DIEELKKDFDSVKVFSAHKSFLENVNDLS 439
            :.|:|..:|.:|.:::|||.|||||||.|.:|    :.|..::..:.:.:...|.:|.:::.|..
Zfish   200 ASAERAALAKTLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRLMIQLQHDAFQKSLTDSV 264

  Fly   440 ILKKKPMHESDMVGL 454
            ......:|.|.:..|
Zfish   265 PTDPLCIHNSSLFAL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 30/53 (57%)
tlx3bNP_739572.1 Homeobox 177..230 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.