DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Npm1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_037124.1 Gene:Npm1 / 25498 RGDID:3192 Length:292 Species:Rattus norvegicus


Alignment Length:194 Identity:29/194 - (14%)
Similarity:69/194 - (35%) Gaps:45/194 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 HMGMNPAIIASEDGSSE------------RSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQ 301
            |:.....:...||..||            ..:||:...|:.   .|::..||::...::..::..
  Rat   110 HISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNK---VPQKKVKLDEDDDEDDEDDED 171

  Fly   302 KKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKK----KRKSRTAFTN 362
            .:..::......::....|:....:.|.....:..:::..|:..:.|:.|.    |::.:|..|.
  Rat   172 DEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTP 236

  Fly   363 HQIFELEKRFLYQKYLSPADRDEIAASLGLS----------NAQVITWFQN-RRAKQKRDIEEL 415
            .               .|:..::|.|.:..|          .|:.|.:.:| .|...:..|::|
  Rat   237 K---------------GPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 10/64 (16%)
Npm1NP_037124.1 Required for interaction with SENP3. /evidence=ECO:0000250 1..185 11/77 (14%)
Necessary for interaction with APEX1. /evidence=ECO:0000250 1..117 1/6 (17%)
Nucleoplasmin 18..117 CDD:397268 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..248 16/127 (13%)
Nuclear localization signal. /evidence=ECO:0000255 152..157 1/4 (25%)
Nuclear localization signal. /evidence=ECO:0000255 190..196 1/5 (20%)
Required for nucleolar localization. /evidence=ECO:0000250 241..292 9/45 (20%)
NPM1-C 243..289 CDD:406641 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.