DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Nkx1-2

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:98 Identity:20/98 - (20%)
Similarity:37/98 - (37%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 KVTKPPAGKLFYIPQRPYMTLGSLRDQIIYPHTHQEMKRRGKTDADLLKYLDLVQLTYLQVREKG 560
            ::...|..:.||   ..|.|..|....:..|.:|..|.:    :.:...:|..|..:::.:||..
Mouse   108 QINTTPQEEAFY---HRYSTSDSPVSALDIPDSHGNMSQ----EMEPFWHLAGVSASFIMLRESS 165

  Fly   561 LDAIEDWIDVLS-----GGEKQRIAMARLFYHN 588
            .:...:...|.|     ..|||.:....|..|:
Mouse   166 ENTEFNMAQVASVTQQETSEKQLMLKYHLLLHD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 11/56 (20%)
Homeodomain 157..213 CDD:459649 9/42 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.