DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Nkx1-2

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:288 Identity:71/288 - (24%)
Similarity:110/288 - (38%) Gaps:75/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LLGPTMPVRPFIPSALLHYEQRLALDYHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRS 270
            :|.|....|..:|...|     .||:..:.|:|                         .|..|.:
Mouse    25 ILDPQKFTRAALPPVRL-----AALEAKKSLEE-------------------------VEAGQDA 59

  Fly   271 SSSN--GSTECCSPRQAEK-LEKLTTQEGSEEAQKKKSEE-----QP-TGSGKSNGDTPLDALFQ 326
            .|.|  ||.|  :|....: ::..:..||||..:::::|:     || ...|...|.....|:..
Mouse    60 CSGNPIGSQE--TPDAVGRGIDPGSPVEGSEAEEEEEAEDAGRAHQPERWQGVHEGSPEARAVAV 122

  Fly   327 MTTKDFDESQDKSHLDIFSNRPQPK-------KKRKSRTAFTNHQIFELEKRFLYQKYLSPADRD 384
            .|.:...|....|.....|.||:.:       |.|::|||||..|:..||.:|...:|||..:|.
Mouse   123 GTEESGAEGLPASPGSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERL 187

  Fly   385 EIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVKVFSAHKSFLENVNDLSILK-----KK 444
            .:|.||.|:..||..||||||.|.|:                      :|......::     .:
Mouse   188 NLALSLSLTETQVKIWFQNRRTKWKK----------------------QNPGADGAVQAGGGAPQ 230

  Fly   445 PMHESDMVGLAAAAAAAGMVVPVPGSVP 472
            |.....:.|...:|..:....||||::|
Mouse   231 PGTPGAVAGGGGSATGSSPGPPVPGALP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 26/53 (49%)
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 26/133 (20%)
Homeobox 160..212 CDD:278475 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 10/68 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.