DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and ceh-30

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_508524.2 Gene:ceh-30 / 191620 WormBaseID:WBGene00000451 Length:237 Species:Caenorhabditis elegans


Alignment Length:178 Identity:56/178 - (31%)
Similarity:77/178 - (43%) Gaps:33/178 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 EEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHL--DIFSNRPQPKKKRKSRTAFTNHQIFEL 368
            |:.|..|..||...|..   |....||..|...|..  |...:....||.||:||.||:.|:.||
 Worm    49 EQSPNNSSHSNDHDPSP---QSIKSDFSTSPRASSPGGDRMGSPGSCKKSRKARTIFTDKQLQEL 110

  Fly   369 EKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVKVFSAHKSFLE 433
            |..|..|||||..||.::|..:||::.||.||:||||.|.||..             ::....|.
 Worm   111 ENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWYQNRRTKWKRQA-------------TSGMDLLS 162

  Fly   434 NVNDLS----ILKKKPMHESDMVGLAAAAAAAGMVVPVPGSVPMGGAP 477
            ...:||    :::..|...:.:..|           |:...:||.|.|
 Worm   163 EPGNLSAVQNLIRSSPYWANYITAL-----------PMGTQLPMMGLP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 28/53 (53%)
ceh-30NP_508524.2 Homeobox 99..151 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.