powered by:
Protein Alignment lbe and ceh-1
DIOPT Version :9
Sequence 1: | NP_524435.2 |
Gene: | lbe / 42542 |
FlyBaseID: | FBgn0011278 |
Length: | 479 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508796.2 |
Gene: | ceh-1 / 191614 |
WormBaseID: | WBGene00000428 |
Length: | 171 |
Species: | Caenorhabditis elegans |
Alignment Length: | 128 |
Identity: | 40/128 - (31%) |
Similarity: | 54/128 - (42%) |
Gaps: | 35/128 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 283 RQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNR 347
|..:.|.:......|:||..:|| |...|||:
Worm 5 RVEDLLSEREKDSNSDEATHQKS---PADGGKSS------------------------------- 35
Fly 348 PQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR 410
:..|.|::|||||..|:..||.:|...:|||..:|..:|..|.||..||..||||||.|.|:
Worm 36 -RKLKMRRARTAFTYEQLVALENKFKTSRYLSVVERLNLAIQLQLSETQVKIWFQNRRTKWKK 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0488 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.