DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Lbx2

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_034822.1 Gene:Lbx2 / 16815 MGIID:1342288 Length:195 Species:Mus musculus


Alignment Length:121 Identity:55/121 - (45%)
Similarity:78/121 - (64%) Gaps:24/121 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 TPLDALFQMTTKDFDESQDKSHLDIFSNRPQP-----------------KKKRKSRTAFTNHQIF 366
            :||.||.::.:|.|.....::       .|||                 :::||||||||..|:.
Mouse    40 SPLCALEELASKTFLGHSPRA-------TPQPSEGRAAPEAPPGPGAGVRRRRKSRTAFTAQQVL 97

  Fly   367 ELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSV 422
            |||:||::||||:|::||.:||.|||:||||:|||||||||.|||:||::.|..|:
Mouse    98 ELERRFVFQKYLAPSERDGLAARLGLANAQVVTWFQNRRAKLKRDVEEMRADVASL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 37/53 (70%)
Lbx2NP_034822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 12/55 (22%)
Homeobox 87..140 CDD:278475 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..195
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831670
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002643
OrthoInspector 1 1.000 - - mtm8764
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5376
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.