DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Lbx1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_034821.2 Gene:Lbx1 / 16814 MGIID:104867 Length:282 Species:Mus musculus


Alignment Length:266 Identity:98/266 - (36%)
Similarity:130/266 - (48%) Gaps:64/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 ASEDGSS---ERSQRSSSSN-----GSTECCSPRQAEK-LEKLTTQE-----GSEEAQKKKSEEQ 308
            :.|||.:   |..:||...:     .|.:..:|...|. |.|.:.:.     |:........:..
Mouse     3 SKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHA 67

  Fly   309 PTG---SGKS--NGDTPLDALFQMTTKDF--------DESQDKSHLDIFSNRPQPKKKRKSRTAF 360
            |.|   :|::  :..:||.||.::.:|.|        ..::.:..:.||..|..|||:|||||||
Mouse    68 PGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAF 132

  Fly   361 TNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVKVF 425
            |||||:||||||||||||||||||:||..|||:||||||||||||||.|||:||:|.|.:|.|  
Mouse   133 TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAK-- 195

  Fly   426 SAHKSFLENVNDLSILKKKPMHESDMVGLA-----------AAAAAAGMVVPVPGSVPM------ 473
                            |..|..:.|:|.||           ......|.....|||..:      
Mouse   196 ----------------KLGPSGQMDIVALAELEQNSEASGGGGGGGCGRAKSRPGSPALPPGAPQ 244

  Fly   474 --GGAP 477
              ||.|
Mouse   245 APGGGP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 47/53 (89%)
Lbx1NP_034821.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 7/32 (22%)
Homeobox 128..182 CDD:395001 47/53 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..282 7/41 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831668
Domainoid 1 1.000 107 1.000 Domainoid score I6523
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472248at2759
OrthoFinder 1 1.000 - - FOG0002643
OrthoInspector 1 1.000 - - mtm8764
orthoMCL 1 0.900 - - OOG6_107037
Panther 1 1.100 - - LDO PTHR24336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5376
SonicParanoid 1 1.000 - - X3367
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.