DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Hoxd4

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus


Alignment Length:106 Identity:40/106 - (37%)
Similarity:56/106 - (52%) Gaps:9/106 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 QPTGSGKSNGDTPL--DALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEK 370
            ||||..:....|.|  .|:.....|       |.|::..:......:.::||||:|..|:.||||
Mouse   112 QPTGPKQPPPGTALKQPAVVYPWMK-------KVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEK 169

  Fly   371 RFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRD 411
            .|.:.:||:...|.|||.:|.||..|:..||||||.|.|:|
Mouse   170 EFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649 28/55 (51%)
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126 5/13 (38%)
Antp-type hexapeptide 131..136 0/4 (0%)
Homeodomain 153..209 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 1/1 (100%)

Return to query results.
Submit another query.