DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Hoxa2

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_034581.1 Gene:Hoxa2 / 15399 MGIID:96174 Length:372 Species:Mus musculus


Alignment Length:97 Identity:41/97 - (42%)
Similarity:51/97 - (52%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 RKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIE----- 413
            |:.|||:||.|:.||||.|.:.|||....|.||||.|.|:..||..||||||.|.||..:     
Mouse   140 RRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQ 204

  Fly   414 ----ELK--KDFDSVKVFSAHKSFLENVNDLS 439
                :.|  :|.|.|:.....||..|....:|
Mouse   205 NSEGKFKNLEDSDKVEEDEEEKSLFEQALSVS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649 31/55 (56%)
Hoxa2NP_034581.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95
Antp-type hexapeptide 96..101
Homeodomain 140..196 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.