DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Dlx5

DIOPT Version :10

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_034186.2 Gene:Dlx5 / 13395 MGIID:101926 Length:289 Species:Mus musculus


Alignment Length:62 Identity:30/62 - (48%)
Similarity:45/62 - (72%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 QPKKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR 410
            :|||.||.||.:::.|:..|::||...:||:..:|.|:||||||:..||..||||:|:|.|:
Mouse   133 KPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeodomain 354..410 CDD:459649 26/55 (47%)
Dlx5NP_034186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:463567
Homeodomain 138..194 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.