DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Barx1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_031552.2 Gene:Barx1 / 12022 MGIID:103124 Length:254 Species:Mus musculus


Alignment Length:309 Identity:80/309 - (25%)
Similarity:103/309 - (33%) Gaps:116/309 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 EPRDHTPSPPSAVPEPQTNQTTKSAIEGVKSFSIADILGHSEKQREESVSPPPNANLLAPPASRP 167
            ||......||....:.:.::        .:||.|           ||.::.||.....||.|:  
Mouse     6 EPGAARFGPPEGCADHRPHR--------YRSFMI-----------EEILTEPPGPKGAAPAAA-- 49

  Fly   168 IAPSGGLLQPRTEPLDVHPAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPS-ALLHYEQRLALD 231
                               ||||..||..|         :...:..|||... |:|..||...  
Mouse    50 -------------------AAAAGELLKFG---------VQALLAARPFHSHLAVLKAEQAAV-- 84

  Fly   232 YHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEG 296
                    |......|...|:..|::|:..|..                .|..|..|.......|
Mouse    85 --------FKFPLAPLGCSGLGSALLAAGPGMP----------------GPAGASHLPLELQLRG 125

  Fly   297 SEEAQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFT 361
            ..||         .|||:...                               :.||.|:|||.||
Mouse   126 KLEA---------AGSGEPGA-------------------------------KAKKGRRSRTVFT 150

  Fly   362 NHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR 410
            ..|:..|||||..|||||..||.::|.|||||..||.||:||||.|.|:
Mouse   151 ELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 33/53 (62%)
Barx1NP_031552.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 4/13 (31%)
Homeobox 145..198 CDD:278475 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.