DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and Barhl2

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001005477.1 Gene:Barhl2 / 104382 MGIID:1859314 Length:384 Species:Mus musculus


Alignment Length:413 Identity:105/413 - (25%)
Similarity:159/413 - (38%) Gaps:120/413 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SGLTRSAVGNLPEDYFHPLKRLRMSSSSSEPRDHTPSPPSAVPEPQTNQTTKSAI--EGVKSFSI 136
            ||....:.|.:..| |..|...|.:...|:.   ||||.|.:....|..::..::  |..:...:
Mouse    19 SGAGSGSPGMMNGD-FRSLGEARTTDFRSQA---TPSPCSEIDTVGTAPSSPISVTLEPPEPHLV 79

  Fly   137 ADILGHSEKQREESVSPPPNA----NLLAPPASRPIAPSGGLLQPRTEPLDVHPAAAAAMLLPSG 197
            .|...|..........|||:|    :|...|..:|  |.    ||::....:..||||.....|.
Mouse    80 TDGPQHHHHLHHSQQPPPPSAVPAQSLQPSPQQQP--PP----QPQSAAQQLGSAAAAPRTSTSS 138

  Fly   198 QIVRPWDHLLGPTMPVRPFIPSALLHYEQRLALDYHRQLQEHFNAQAQLLRHMGMNPAIIASEDG 262
            .:::   .:||.:.|:....|     |...::..:|...||                        
Mouse   139 FLIK---DILGDSKPLAACAP-----YSTSVSSPHHTPKQE------------------------ 171

  Fly   263 SSERSQRSSSSNGSTECCSPRQAEKLEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDTPLDALFQM 327
                      ||.:.|...|       ||..::|..:..|:   |.|....|.:|          
Mouse   172 ----------SNAAHESFRP-------KLEQEDGKTKLDKR---EDPQSDIKCHG---------- 206

  Fly   328 TTKDFDESQDKSHLDIFSNRPQP----KKKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAA 388
                   ::::...:|.|:|..|    ||.||:||||::||:.:||:.|..|||||..||.::||
Mouse   207 -------TKEEGDREITSSRESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAA 264

  Fly   389 SLGLSNAQVITWFQNRRAKQKR-------------DIEELKKDFDSVKVFSAHKSFLENVNDLSI 440
            :|.|::.||.||:||||.|.||             :...|::.|.|...:  |.|.|        
Mouse   265 ALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFY--HPSLL-------- 319

  Fly   441 LKKKPMHESDMVGLAAAAAAAGM 463
                    ..|....||||||.|
Mouse   320 --------GSMDSTTAAAAAAAM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 29/53 (55%)
Barhl2NP_001005477.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134 31/124 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..235 26/146 (18%)
Homeobox 233..285 CDD:278475 29/51 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.