DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and dbx1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_002940015.1 Gene:dbx1 / 100495433 XenbaseID:XB-GENE-480177 Length:328 Species:Xenopus tropicalis


Alignment Length:341 Identity:75/341 - (21%)
Similarity:105/341 - (30%) Gaps:125/341 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 NLLAPPASRPIAPSGGLLQPRTEPLDVHPAAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSALL 222
            :||||||..|     .||:|.                              ||:.:...|.:||.
 Frog     5 SLLAPPAVYP-----NLLRPT------------------------------PTLTLPQSIQTALS 34

  Fly   223 HYEQRLALDYHRQLQEHFNAQAQLLRHMGMNPAIIASEDGSSERSQRSSSSNGSTECCSPRQAEK 287
            .:...|..|..|           :.|..|..|..:.....|...|.            ||....:
 Frog    35 SHTSFLIEDLIR-----------ISRPAGFLPRAVPPPSMSPPTSD------------SPTSLSE 76

  Fly   288 LEKLTTQEGSEEAQKKKSEEQPTGSGKSNGDT----------------------------PLDAL 324
            :..|..:|.            ||....:|..|                            |....
 Frog    77 VPDLARREA------------PTSISSNNSSTFLKFGVNAILSASPRTETCPALPPSVAPPKAFA 129

  Fly   325 FQMTTKDFDESQDKSHLDIFSN--------------RPQPKKKRKSRTAFTNHQIFELEKRFLYQ 375
            |......|......|:....|:              |.:|::....|..|::.|...|||.|..|
 Frog   130 FPYFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQ 194

  Fly   376 KYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKRDIE-ELK-----KDFDSVKVFSAHKSFLEN 434
            ||:|..||.::|..|||.::||..||||||.|.:...| ||.     ::......|:.|.     
 Frog   195 KYISKPDRKKLAGKLGLKDSQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKFNPHP----- 254

  Fly   435 VNDLSILKKKPMHESD 450
              |||.:.||...|.:
 Frog   255 --DLSDVGKKSSGEGE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 26/53 (49%)
dbx1XP_002940015.1 Homeobox 175..229 CDD:365835 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.