DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and ventx2.2

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_002937178.3 Gene:ventx2.2 / 100494704 XenbaseID:XB-GENE-920515 Length:333 Species:Xenopus tropicalis


Alignment Length:358 Identity:83/358 - (23%)
Similarity:131/358 - (36%) Gaps:76/358 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 KSFSIADILGHSEKQREESVSPPPNANLLAPPASRPIAPSGGLLQPRTEPLDVHPAAAAAMLLPS 196
            |:||..:.|..|.::..:  ..|...:....|...|..||..        .||.|::        
 Frog    12 KAFSSVEWLAQSSRRSHK--EQPSKGDQRYSPYPSPSLPSWN--------SDVSPSS-------- 58

  Fly   197 GQIVRPWDHLLGP---TMPVRPFIPSALLHYEQRLALDYHRQLQEHFNAQAQLLRHMGMNPAIIA 258
                  |:..|.|   :..|.|...||....:...:|        :.|....|.....:|.....
 Frog    59 ------WNSQLSPVAGSAQVSPCPGSAQYSSDSESSL--------YSNEDEDLFCEKDLNTPSTP 109

  Fly   259 SEDGSSERSQRSSSSNG--STECCSPR------QAEKLEKLTTQEGSEEAQKKKSEEQPTGSGKS 315
            .::|...:...:...:|  |....:||      .|:.....:|..|.|....:.|...|.|    
 Frog   110 GDNGLLHKDTATHDYSGMVSVPANTPRTTSNEDAAKSGYSTSTDSGYESEASRSSSTAPEG---- 170

  Fly   316 NGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQPKKKRKSRTAFTNHQIFELEKRFLYQKYLSP 380
                  ||...::..|..:.:.             |..|:.|||||:.||..|||.|...:||..
 Frog   171 ------DATVSLSPNDTSDEEG-------------KLGRRLRTAFTSDQISTLEKTFQKHRYLGA 216

  Fly   381 ADRDEIAASLGLSNAQVITWFQNRRAKQKRDIEELKKDFDSVKVFSAHKSFLENVNDLSILKKKP 445
            ::|.::||.|.||..|:.|||||||.|.||:|::.:.|       |.|.:....|...|   ::|
 Frog   217 SERRKLAAKLQLSEVQIKTWFQNRRMKYKREIQDGRPD-------SYHPAQFFGVYGYS---QQP 271

  Fly   446 MHESDMVGLAAAAAAAGMVVPVPGSVPMGGAPP 478
            ...............:.::..:||::|....||
 Frog   272 TPVFQHAVQQPYPGYSPLMETLPGTMPYAMHPP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 28/53 (53%)
ventx2.2XP_002937178.3 Homeobox 193..246 CDD:395001 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.