DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbe and barhl1

DIOPT Version :9

Sequence 1:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_004916717.1 Gene:barhl1 / 100491447 XenbaseID:XB-GENE-853661 Length:327 Species:Xenopus tropicalis


Alignment Length:403 Identity:102/403 - (25%)
Similarity:154/403 - (38%) Gaps:130/403 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IEGVKSFSIADILGHSEKQREESVSPPPNANLLAPPASRPIAPSGGLLQPRT------EPLDVHP 186
            :||...|.|..||.|.                         |.|.||.|..|      .||::.|
 Frog     1 MEGANGFGIDTILSHR-------------------------AGSPGLAQGDTLMGESRSPLELSP 40

  Fly   187 AAAAAMLLPSGQIVRPWDHLLGPTMPVRPFIPSALLHYEQRLALDYHRQLQEHFNAQAQ------ 245
            ::..:.:..|            |..|.|..:..........||::.|.|.....:|.:|      
 Frog    41 SSEVSSVCSS------------PPSPDRDCLDGVAGRQGVALAMESHLQPGVQLSAPSQSRTVTS 93

  Fly   246 --LLRHMGMNPAIIASEDGSSERSQRSSSSNGS-----TECCSPRQA----EKLEKLTTQEGSEE 299
              |:|.      |:|  |.....:....||||.     ..|.:.:.|    :||:|.::...||.
 Frog    94 SFLIRD------ILA--DCKPLATCAPYSSNGQPTHDLAHCLASKAADDFRDKLDKSSSSTSSES 150

  Fly   300 AQKKKSEEQPTGSGKSNGDTPLDALFQMTTKDFDESQDKSHLDIFSNRPQP----KKKRKSRTAF 360
            ..|.|.:|:        ||.                      :|.|:|..|    ||.||:||||
 Frog   151 EYKGKVKEE--------GDR----------------------EISSSRDSPPVRLKKPRKARTAF 185

  Fly   361 TNHQIFELEKRFLYQKYLSPADRDEIAASLGLSNAQVITWFQNRRAKQKR-------------DI 412
            |:||:.:||:.|..|||||..||.|:||||.|::.||.||:||||.|.||             :.
 Frog   186 TDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNY 250

  Fly   413 EELKKDFDSVKVFSAHKSFLENVNDLSIL------------KKKPMHESDMV-GLAAAAAAAGMV 464
            ..|::.|.|...:.  :|.:.|::..:.|            .::|:....:: ||...:.....:
 Frog   251 SALQRMFPSPYFYP--QSLVSNLDPGAALYLYRGPTAPPPALQRPLVPRILIHGLQGGSEPPPAL 313

  Fly   465 VPVPGSVPMGGAP 477
            .|:.|.:|....|
 Frog   314 PPLTGVLPRAAQP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lbeNP_524435.2 Homeobox 356..410 CDD:395001 32/53 (60%)
barhl1XP_004916717.1 Homeobox 182..235 CDD:365835 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.