DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and YOX1

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 / 854981 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:367 Identity:78/367 - (21%)
Similarity:116/367 - (31%) Gaps:131/367 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PPLRSLNMKRLRLLRSPISLEHDRQKSSPVRVKSFSIADILGRGHEEDRVEKKPERIAIPNALPG 85
            |.|.|| :....:..||:|......::|               .|.:||...|         || 
Yeast     9 PSLSSL-LSGTEISSSPVSPSFTNPRTS---------------FHLDDRGTIK---------LP- 47

  Fly    86 VPAPL-ALINERLQIPLVPNCPPPAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQM 149
               || ..||.       |.....|..||..|   ||.....    |...:.:|.|:.:.|    
Yeast    48 ---PLNTSINR-------PRSVESALRHTVTS---LHENSSA----YGDDMLKHTQSDSAL---- 91

  Fly   150 TLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSS 214
                               ||..|.|.|...         .|.|:.:..|..|.:.....:||.:
Yeast    92 -------------------SSQLNSSQETVD---------ESHENLLLTPLNSKKRDYSVSSKKN 128

  Fly   215 GD-TPLDALFQLSTKNFDEEQDPATLNIFATRSN---PKKK---------RKSRTAFTNQQIFEL 266
            .. |||.|...:...:..:|:..|.  .|.|.|.   |||:         |:.|...::|::..|
Yeast   129 DILTPLSAAKSIIIPSASKEKRRAF--AFITHSQETFPKKEPKIDNAPLARRKRRRTSSQELSIL 191

  Fly   267 EKRFLYQKYLSPA--DRDEIAGGLGLSNAQVITWFQNRRAKLKRD-------------------- 309
            :..|  :|..:|:  .|.|:|....::...|..||||:|..:||.                    
Yeast   192 QAEF--EKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQRIATSKSTTIIQTVSPPSPP 254

  Fly   310 --------MEELKKDV-----QCEKIPDQSA---DPNRSHHN 335
                    ...:|.|:     .|.:....|.   .|.|.||:
Yeast   255 LDVHATPLASRVKADILRDGSSCSRSSSSSPLENTPPRPHHS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 37/176 (21%)
Homeobox 254..307 CDD:278475 15/54 (28%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 31/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.