DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and LBX2

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens


Alignment Length:154 Identity:68/154 - (44%)
Similarity:94/154 - (61%) Gaps:26/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 VPK--KSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNP---------KKK 251
            ||:  .:|:....|...:|   ||.||.:|::|.| ...|...|.....|:.|         :|:
Human    25 VPRAPSAPQLPESGPGPTS---PLCALEELTSKTF-RGLDARALQPSEGRAGPDALGPGPFGRKR 85

  Fly   252 RKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKD 316
            ||||||||.||:.|||:||::||||:|::||.:|..|||:||||:|||||||||||||:||::.|
Human    86 RKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVEEMRAD 150

  Fly   317 VQ----------CE-KIPDQSADP 329
            |.          |. .:|:.:.||
Human   151 VASLRALSPEVLCSLALPEGAPDP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 65/144 (45%)
Homeobox 254..307 CDD:278475 37/52 (71%)
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 6/25 (24%)
Homeobox 88..141 CDD:278475 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141719
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472248at2759
OrthoFinder 1 1.000 - - FOG0002643
OrthoInspector 1 1.000 - - mtm8534
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5376
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.