DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HDG11

DIOPT Version :10

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_177479.1 Gene:HDG11 / 843671 AraportID:AT1G73360 Length:722 Species:Arabidopsis thaliana


Alignment Length:110 Identity:35/110 - (31%)
Similarity:49/110 - (44%) Gaps:26/110 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 TRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLK- 307
            :.::.||||..|  .|.|||..||..|....:.....|::::..|||:..|:..||||||.:|| 
plant    27 SETDRKKKRYHR--HTAQQIQRLESSFKECPHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQLKA 89

  Fly   308 ----RDMEELKKD---VQCEKI----------------PDQSADP 329
                .|...||.:   ::||.|                |..|.||
plant    90 QHERADNSALKAENDKIRCENIAIREALKHAICPNCGGPPVSEDP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 35/110 (32%)
Homeodomain 252..308 CDD:459649 22/60 (37%)
HDG11NP_177479.1 Homeodomain 33..88 CDD:459649 22/56 (39%)
START_ArGLABRA2_like 231..456 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.