DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HB18

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:136 Identity:40/136 - (29%)
Similarity:59/136 - (43%) Gaps:29/136 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 MEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDP-----------ATLNIFATRSNPK 249
            :.:|..||       |.|.||       ....::||..|.|           ||.::....||..
plant    14 ISIPSFSP-------SPSLGD-------HHGMRDFDINQTPKTEEDREWMIGATPHVNEDDSNSG 64

  Fly   250 KKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELK 314
            .:|:.:...|.:|...||:.|:....|:|..:.::|..|.||..||..|||||||:.|....|: 
plant    65 GRRRKKLRLTKEQSHLLEESFIQNHTLTPKQKKDLATFLKLSQRQVEVWFQNRRARSKLKHTEM- 128

  Fly   315 KDVQCE 320
               :||
plant   129 ---ECE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 37/126 (29%)
Homeobox 254..307 CDD:278475 20/52 (38%)
HB18NP_177248.3 HOX 66..122 CDD:197696 21/55 (38%)
HALZ 124..167 CDD:420073 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.