DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HB5

DIOPT Version :10

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_201334.1 Gene:HB5 / 836656 AraportID:AT5G65310 Length:312 Species:Arabidopsis thaliana


Alignment Length:166 Identity:46/166 - (27%)
Similarity:68/166 - (40%) Gaps:34/166 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 QRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKS-SGDTPLDALFQLSTKNF 230
            :||..|:.|.....|.:....:|:.          ||.....|...| :||         .::.|
plant     2 KRSRGSSDSLSGFLPIRHSTTDKQI----------SPRPTTTGFLYSGAGD---------YSQMF 47

  Fly   231 DEEQDPATLNIF-----ATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGL 290
            |..:|..:|...     |:.:..:|||:...    :|:..|||.|.....|.|..:.::|..|||
plant    48 DALEDDGSLEDLGGVGHASSTAAEKKRRLGV----EQVKALEKNFEIDNKLEPERKVKLAQELGL 108

  Fly   291 SNAQVITWFQNRRAK-----LKRDMEELKKDVQCEK 321
            ...||..|||||||:     |:||...||.:....|
plant   109 QPRQVAIWFQNRRARWKTKQLERDYGVLKSNFDALK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 38/127 (30%)
Homeodomain 252..308 CDD:459649 22/60 (37%)
HB5NP_201334.1 Homeodomain 72..125 CDD:459649 23/56 (41%)
HALZ 127..168 CDD:460477 6/18 (33%)

Return to query results.
Submit another query.