DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HAT14

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_196289.2 Gene:HAT14 / 830560 AraportID:AT5G06710 Length:336 Species:Arabidopsis thaliana


Alignment Length:364 Identity:82/364 - (22%)
Similarity:119/364 - (32%) Gaps:137/364 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DILGRGHE----------EDRVEKKPERIAIPNALPGVPAPLALINERLQIPLVPNCPPPAALHT 113
            |:...||.          ||  |||.            |||.|..::..::.  .:..||.    
plant    46 DVAFGGHRSLSSSSSPSVED--EKKK------------PAPRAKKSDEFRVS--SSVDPPL---- 90

  Fly   114 FLSPALLHSYEQRLAWDYQRQLQEHF------QAQAQLLRQMTLNPAIIASEDGSSERSQRSSSS 172
                                |||.||      .::.:...:|.|..|.:..|:...|.:..|.|.
plant    91 --------------------QLQLHFPNWLPENSKGRQGGRMPLGAATVVEEEEEEEEAVPSMSV 135

  Fly   173 NGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPA 237
            :......|..|.:...|....:|....:...:|..:.||::|.:           .|.||     
plant   136 SPPDSVTSSFQLDFGIKSYGYERRSNKRDIDDEVERSASRASNE-----------DNDDE----- 184

  Fly   238 TLNIFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNR 302
                  ..|..||.|.|:    :|..| ||..|.....|:|..:..:|..|.|...||..|||||
plant   185 ------NGSTRKKLRLSK----DQSAF-LEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNR 238

  Fly   303 RA--KLKR---DMEELKKDVQCEKIPDQSADPNRSHHNHPHYHQQHQHYAHMQSIGSDRDMDKDR 362
            ||  |||:   |.|.||:  .||.:.:::                                    
plant   239 RARTKLKQTEVDCEYLKR--CCESLTEEN------------------------------------ 265

  Fly   363 CREKEKDKDKEELRMLKLMTLMRYSDGKLLYQQPPASYL 401
               :...|:.:|||.||..|        ..|.|.||:.|
plant   266 ---RRLQKEVKELRTLKTST--------PFYMQLPATTL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 39/130 (30%)
Homeobox 254..307 CDD:278475 21/54 (39%)
HAT14NP_196289.2 HOX 187..243 CDD:197696 24/60 (40%)
HALZ 245..288 CDD:128634 15/91 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.