DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HAT22

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_195493.1 Gene:HAT22 / 829935 AraportID:AT4G37790 Length:278 Species:Arabidopsis thaliana


Alignment Length:272 Identity:62/272 - (22%)
Similarity:94/272 - (34%) Gaps:97/272 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 RQMTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGAS 211
            |.:.|:|::..|..|.|.:.:  :.:....:.|..|.:.                      .|.|
plant    38 RFIRLDPSLTLSLSGESYKIK--TGAGAGDQICRQTSSH----------------------SGIS 78

  Fly   212 K-SSGDTPLDALFQLSTKNFDEEQDPATLNIFATR-----------SNPKKKRKSRTAFTNQQIF 264
            . |||....:.  ::|..:.:||.:..|..:..:|           |..||.|     .|.||..
plant    79 SFSSGRVKRER--EISGGDGEEEAEETTERVVCSRVSDDHDDEEGVSARKKLR-----LTKQQSA 136

  Fly   265 ELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRA--KLKR---DMEELKKDVQCEKIPD 324
            .||..|.....|:|..:..:|..|.|...||..|||||||  |||:   |.|.|||  .||.:.|
plant   137 LLEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKK--CCETLTD 199

  Fly   325 QSADPNRSHHNHPHYHQQHQHYAHMQSIGSDRDMDKDRCREKEKDKDKEELRMLKLMTLMRYSDG 389
            ::                                       :...|:.::|:.|||        .
plant   200 EN---------------------------------------RRLQKELQDLKALKL--------S 217

  Fly   390 KLLYQQPPASYL 401
            :..|...||:.|
plant   218 QPFYMHMPAATL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 45/142 (32%)
Homeobox 254..307 CDD:278475 21/54 (39%)
HAT22NP_195493.1 Homeobox 129..179 CDD:278475 21/54 (39%)
HALZ 181..224 CDD:128634 15/91 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.