DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HAT3

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_191598.1 Gene:HAT3 / 825210 AraportID:AT3G60390 Length:315 Species:Arabidopsis thaliana


Alignment Length:299 Identity:68/299 - (22%)
Similarity:101/299 - (33%) Gaps:92/299 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HSYEQRL--AWDYQRQLQEHFQAQAQLLRQMTLNPA----IIASEDG----SSERSQRSSSSNGS 175
            :::.|::  .|....|..|........||.:.:|.|    ::..||.    ||..|..||..:| 
plant    49 YNHPQKIQNTWINMFQSSERNSDMRSFLRGIDVNRAPSTVVVDVEDEGAGVSSPNSTVSSVMSG- 112

  Fly   176 TECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLN 240
                                    |||..|....|....|....|...:.::.:.....|....:
plant   113 ------------------------KKSERELMAAAGAVGGGRVEDNEIERASCSLGGGSDDEDGS 153

  Fly   241 IFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRA- 304
            .....|:.||.|.|:     :|...||:.|.....|:|..:..:|..|.|...||..||||||| 
plant   154 GNGDDSSRKKLRLSK-----EQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRAR 213

  Fly   305 -KLKR---DMEELKKDVQCEKIPDQSADPNRSHHNHPHYHQQHQHYAHMQSIGSDRDMDKDRCRE 365
             |||:   |.|.||:  .||.:.|::                                       
plant   214 TKLKQTEVDCEYLKR--CCENLTDEN--------------------------------------- 237

  Fly   366 KEKDKDKEELRMLKLMTLMRYSDGKLLYQQPPASYLPIP 404
            :...|:..|||.|||      |....::.:||.:....|
plant   238 RRLQKEVSELRALKL------SPHLYMHMKPPTTLTMCP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 37/130 (28%)
Homeobox 254..307 CDD:278475 20/54 (37%)
HAT3NP_191598.1 HD-ZIP_N 19..118 CDD:398351 19/93 (20%)
Homeobox 165..215 CDD:395001 20/54 (37%)
HALZ 217..260 CDD:128634 16/89 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.