DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and lbx1

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001072559.1 Gene:lbx1 / 780014 XenbaseID:XB-GENE-6455157 Length:265 Species:Xenopus tropicalis


Alignment Length:137 Identity:80/137 - (58%)
Similarity:95/137 - (69%) Gaps:19/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SPEEQPKGA-----SKS--SGDTPLDALFQLSTKNFD----------EEQDPATLNIFATRSNPK 249
            |..|:|..|     |::  |..:||.||.:|::|.|.          |.:|..|  ||..|..||
 Frog    61 STAEKPPAAGLPLSSRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMT--IFGQRQTPK 123

  Fly   250 KKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELK 314
            |:|||||||||.||:||||||||||||||||||:||..|||:||||||||||||||||||:||:|
 Frog   124 KRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMK 188

  Fly   315 KDVQCEK 321
            .||:..|
 Frog   189 ADVESVK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 78/133 (59%)
Homeobox 254..307 CDD:278475 46/52 (88%)
lbx1NP_001072559.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
Homeobox 128..182 CDD:365835 47/53 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6422
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472248at2759
OrthoFinder 1 1.000 - - FOG0002643
OrthoInspector 1 1.000 - - mtm9428
Panther 1 1.100 - - O PTHR24336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5376
SonicParanoid 1 1.000 - - X3367
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.