DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and barx1

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001020120.1 Gene:barx1 / 553644 ZFINID:ZDB-GENE-050522-28 Length:248 Species:Danio rerio


Alignment Length:175 Identity:54/175 - (30%)
Similarity:80/175 - (45%) Gaps:47/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SSGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLS 277
            ||...|||.       :...:.||....:    |..||.|:|||.||..|:..|||||..|||||
Zfish   108 SSHHLPLDL-------HLRGKLDPGADAV----SKTKKGRRSRTVFTELQLMGLEKRFEKQKYLS 161

  Fly   278 PADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEE---LKKDVQCEKIPDQSADPNRSHHNHPHY 339
            ..||.::|..||||..||.||:||||.|.|:.:.:   |:...:.:..|.:::.|.         
Zfish   162 TPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPT--------- 217

  Fly   340 HQQHQHYAHMQSIGSDRDMDKDRCREKEK----------DKDKEE 374
                          |::..:::|.||.::          |.::||
Zfish   218 --------------SEQLSEQERTREADRLSDGGASSLSDANQEE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 47/121 (39%)
Homeobox 254..307 CDD:278475 32/52 (62%)
barx1NP_001020120.1 Homeobox 138..191 CDD:278475 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..248 8/73 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.