DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and npm1b

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_005173145.2 Gene:npm1b / 553507 ZFINID:ZDB-GENE-080723-7 Length:316 Species:Danio rerio


Alignment Length:122 Identity:26/122 - (21%)
Similarity:52/122 - (42%) Gaps:27/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PAI---IASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSS 214
            ||:   :.|...:.|:.:.:...|||        .:|....|.:.:.:.|:|..:   |.|:..|
Zfish   202 PAVKSPVKSTQKTPEKKKSADKQNGS--------PDKKAGTSGKPQTQTPQKVKD---KSAAGPS 255

  Fly   215 GDTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRK----SRTAF--TNQQIFE 265
            |.||       |..:..|.:...|......:..||.::|    :|::|  :::|:.:
Zfish   256 GKTP-------SIPSLSEVKSKLTSAAKEGKPFPKTEQKFENFARSSFKISDKQVIK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 15/66 (23%)
Homeobox 254..307 CDD:278475 3/14 (21%)
npm1bXP_005173145.2 Nucleoplasmin 32..131 CDD:308605
NPM1-C 265..313 CDD:318505 8/41 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.