DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and barhl1a

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001017712.2 Gene:barhl1a / 550407 ZFINID:ZDB-GENE-050417-212 Length:299 Species:Danio rerio


Alignment Length:202 Identity:63/202 - (31%)
Similarity:97/202 - (48%) Gaps:41/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LLRQMTLNPAIIASEDGS-SERSQRSSSSNGSTECCSPTQA---EKVEKRSQEDRMEVPKKSPEE 205
            :|.....:|.:...|..| :|.|.||...:|.:...||.::   :.|::|::...::.|.:. .:
Zfish    14 ILSHRASSPCMSKGECRSPAELSPRSDLDSGCSSPPSPRRSSVEDAVQRRARALGLDSPLQI-SQ 77

  Fly   206 QPK---------------------------GASKSSGDTPLDALFQLSTKNFDEE---QDPATLN 240
            ||:                           |.|....:..:|.|.  |..:.|.|   :|.|...
Zfish    78 QPRTVTSSFLIRDILADCKPLAACAPYSSTGQSAQDAEDCMDKLH--SNSSSDSEYRVKDEADRE 140

  Fly   241 IFATRSNP----KKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQN 301
            |.::|.:|    ||.||:|||||:.|:.:||:.|..|||||..||.|:|..|.|::.||.||:||
Zfish   141 ISSSRDSPNSRLKKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQN 205

  Fly   302 RRAKLKR 308
            ||.|.||
Zfish   206 RRTKWKR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 49/137 (36%)
Homeobox 254..307 CDD:278475 29/52 (56%)
barhl1aNP_001017712.2 TPP_enzymes <122..177 CDD:294952 21/56 (38%)
Homeobox 159..211 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.