DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Dbx2

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_001053826.1 Gene:Dbx2 / 541457 RGDID:1359605 Length:377 Species:Rattus norvegicus


Alignment Length:428 Identity:99/428 - (23%)
Similarity:136/428 - (31%) Gaps:153/428 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RTPSPANS---DVSVGSPSPPPLRSLNMKRLRLLRSPISLE----HDRQKSSPV----------R 51
            |:|.||.:   .....||..|..|:..|     |.|.::.:    .|...||.:          .
  Rat    37 RSPDPAGALSRSPRTRSPRLPGQRARTM-----LPSAVAAQAGAYWDVVASSALLGLPAPGFGSL 96

  Fly    52 VKSFSIADILGRGHEEDRVEKKPERIAIP-----NALPGVPAPLALINERLQIPLVPNCP--PPA 109
            .|||.|.::|..|.........|...|.|     .:||..|.||.|            ||  |..
  Rat    97 GKSFLIENLLRAGAGPTHAPPSPRPAAGPECPQLRSLPANPVPLKL------------CPAGPFG 149

  Fly   110 ALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQ---MTLNPAIIASEDGSSERSQRSSS 171
            |...|..|......|:..|          ||..|.:..:   ::..|...|...||..|.     
  Rat   150 ARWAFQMPPGRAPGERDSA----------FQPSAPVPSKPFLLSAGPFYSACCGGSCRRP----- 199

  Fly   172 SNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDP 236
                   .|||.                                              |..|:. 
  Rat   200 -------ASPTA----------------------------------------------FSREEH- 210

  Fly   237 ATLNIFATRSNPKKKR--KSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWF 299
             .|.:....||.|.:|  ..|..|:..|...|||.|..|||:|..||.::|..|||..:||..||
  Rat   211 -GLPLLTQDSNSKARRGILRRAVFSEDQRKALEKMFQKQKYISKTDRRKLAISLGLKESQVKIWF 274

  Fly   300 QNRRAKLKRDMEE------------LKKD----------VQCEKIPDQSADPNRSHHNHPHYHQQ 342
            ||||.|.:...|:            |::|          .||..:.:.|     ..|:.|.:.::
  Rat   275 QNRRMKWRNSKEKEVLSNRCLQEVSLQEDRLAQPAAGCPPQCPSVWEVS-----QPHSSPSWREE 334

  Fly   343 --------HQHYAHMQSIGSDRDMDKDRCREK-EKDKD 371
                    .|..:.:...||.|.: ...|.|| .:|||
  Rat   335 SPESVERLSQENSGVPEAGSLRGV-LYLCPEKGPRDKD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 39/149 (26%)
Homeobox 254..307 CDD:278475 26/52 (50%)
Dbx2XP_001053826.1 Homeobox 229..282 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.