DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HGTX

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster


Alignment Length:474 Identity:105/474 - (22%)
Similarity:150/474 - (31%) Gaps:190/474 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PQRTPSPANSDV-SVGSPSPPPLRSLNMKRLRLLRSPISLEHDRQKSSP--VRVKSFSIADILGR 63
            |..||.||:|.: |..||||                  ..||:   |||  ...||::::. ...
  Fly   179 PSTTPPPASSRLHSDSSPSP------------------RYEHN---SSPGVDSAKSYALSQ-RSS 221

  Fly    64 GHE-------------EDRVEKKPERIAIPNAL----PGVPAPLALINER--------------- 96
            |.|             :.:.:..||.::...|.    .|| .||||.|..               
  Fly   222 GAEDPCQTSESASPPPQGQNDYSPENLSSQRAKFQHHHGV-NPLALHNANHAGNPGCHNNNNHMD 285

  Fly    97 LQIPLVPNCPPPAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDG 161
            .::||....||.||||:             :..:.:.|......|.|..|.......:.:.|:.|
  Fly   286 HKLPLSFLGPPLAALHS-------------MTTEMKGQGVGGSSASANGLSYSHSPNSHLISDRG 337

  Fly   162 SSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSG----------- 215
            |...|..||::..:|..........::        .:..|.|.....|.|..:|           
  Fly   338 SGGSSSSSSTTTTNTNSQGAPNPHGID--------TILSKPPPVTSAGLSALTGAGIPRFSIAAA 394

  Fly   216 ------------DTPL-----------------------------DALFQLSTKNFDE--EQDPA 237
                        ..||                             :.|....:.|..:  :..| 
  Fly   395 AAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHP- 458

  Fly   238 TLNIFATRSNPK--KKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQ 300
                    ||.|  ||:.:|..|:.||||.|||.|...|||:..:|.::|..||:|.:||..|||
  Fly   459 --------SNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQ 515

  Fly   301 NRRAKLKRDMEELKKDVQCEKIPDQSADPNRSHHNHPHYHQQHQHYAHM-------QSIGSDRDM 358
            |||.|.::                                   :|.|.|       ..:|.|.|.
  Fly   516 NRRTKWRK-----------------------------------RHAAEMATAKRKQDDMGGDNDG 545

  Fly   359 DKDRCREKEKDKDKEELRM 377
            |   |.| ..|.|.|.|.|
  Fly   546 D---CSE-TMDSDNESLDM 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 40/181 (22%)
Homeobox 254..307 CDD:278475 27/52 (52%)
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 54/252 (21%)
Homeobox 469..523 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.