DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Lbx2

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001102714.1 Gene:Lbx2 / 500224 RGDID:1561172 Length:196 Species:Rattus norvegicus


Alignment Length:149 Identity:66/149 - (44%)
Similarity:91/149 - (61%) Gaps:28/149 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 PEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNP----------KKKRKSRTA 257
            ||..|..||      ||.||.:|::|.| :...|........|:.|          :::||||||
  Rat    32 PEAGPDPAS------PLCALEELASKTF-QGHSPRAPQPSEGRAVPEAPPGPGTGVRRRRKSRTA 89

  Fly   258 FTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKD------ 316
            ||.||:.|||:||::||||:|::||.:|..|||:||||:|||||||||||||:||::.|      
  Rat    90 FTPQQVLELERRFVFQKYLAPSERDGLAARLGLANAQVVTWFQNRRAKLKRDVEEMRADLASLCG 154

  Fly   317 ----VQC-EKIPDQSADPN 330
                |.| ..:||.::.|:
  Rat   155 LSPGVLCPPALPDSASSPD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 64/146 (44%)
Homeobox 254..307 CDD:278475 37/52 (71%)
Lbx2NP_001102714.1 Homeobox 86..139 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472248at2759
OrthoFinder 1 1.000 - - FOG0002643
OrthoInspector 1 1.000 - - mtm9009
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24336
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.