DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Lbx1

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001040573.1 Gene:Lbx1 / 499362 RGDID:1564197 Length:285 Species:Rattus norvegicus


Alignment Length:251 Identity:100/251 - (39%)
Similarity:123/251 - (49%) Gaps:75/251 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ALPGVPAPLALINERLQIPLVPNCPPPAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLL 146
            |.||        .||.:.|| .:.||||..:..|:|   .|.|..|.                  
  Rat     9 AAPG--------EERRRSPL-DHLPPPANSNKPLTP---FSIEDILN------------------ 43

  Fly   147 RQMTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQP-KGA 210
                 .|::           :||.|..|:....:...                |.:|...| .|.
  Rat    44 -----KPSV-----------RRSYSLCGAAHLLAAAD----------------KHAPGGLPLAGR 76

  Fly   211 SKSSGDTPLDALFQLSTKNFD----------EEQDPATLNIFATRSNPKKKRKSRTAFTNQQIFE 265
            :..|..:||.||.:|::|.|.          |.:|..|  ||..|..|||:|||||||||.||:|
  Rat    77 ALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMT--IFGQRQTPKKRRKSRTAFTNHQIYE 139

  Fly   266 LEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKDVQCEK 321
            |||||||||||||||||:||..|||:||||||||||||||||||:||:|.||:..|
  Rat   140 LEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 77/127 (61%)
Homeobox 254..307 CDD:278475 46/52 (88%)
Lbx1NP_001040573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 13/38 (34%)
Homeobox 128..181 CDD:278475 46/52 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335405
Domainoid 1 1.000 107 1.000 Domainoid score I6393
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1472248at2759
OrthoFinder 1 1.000 - - FOG0002643
OrthoInspector 1 1.000 - - mtm9009
orthoMCL 1 0.900 - - OOG6_107037
Panther 1 1.100 - - O PTHR24336
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3367
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.710

Return to query results.
Submit another query.