powered by:
Protein Alignment lbl and Tlx3
DIOPT Version :9
Sequence 1: | NP_001262805.1 |
Gene: | lbl / 42541 |
FlyBaseID: | FBgn0008651 |
Length: | 410 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_573065.4 |
Gene: | Tlx3 / 497881 |
RGDID: | 1564190 |
Length: | 291 |
Species: | Rattus norvegicus |
Alignment Length: | 65 |
Identity: | 35/65 - (53%) |
Similarity: | 46/65 - (70%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 248 PKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEE 312
|.|::|.||:|:..||.||||||..||||:.|:|..:|..|.:::|||.|||||||.|.:|...|
Rat 163 PPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAE 227
Fly 313 312
Rat 228 227
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.