DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and DBX2

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001004329.2 Gene:DBX2 / 440097 HGNCID:33186 Length:339 Species:Homo sapiens


Alignment Length:324 Identity:79/324 - (24%)
Similarity:112/324 - (34%) Gaps:106/324 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KSFSIADILGRGHEEDRVEKKPERIAIPNALPGVPAPLALINERLQIPLVPNCPPPAALHTFLSP 117
            |||.|.::|..|                    |.|.|      ||| |..|: .|..||.|    
Human    36 KSFLIENLLRVG--------------------GAPTP------RLQ-PPAPH-DPATALAT---- 68

  Fly   118 ALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDGSSERSQRSS--SSNGSTECCS 180
                                   |.|| ||.:..:|..:.....:.:.|...:  .:..:.:..|
Human    69 -----------------------AGAQ-LRPLPASPVPLKLCPAAEQVSPAGAPYGTRWAFQVLS 109

  Fly   181 PTQAEKVEKRSQEDRMEVPKKSPEE-----QPKGASKSSGDTPLDALFQLSTKNFDE-------- 232
            |:          .|...:|.::|.:     ||...:.|..       |.|||..|..        
Human   110 PS----------ADSARLPGRAPGDRDCTFQPSAPAPSKP-------FLLSTPPFYSACCGGSCR 157

  Fly   233 --------EQDPATLNIFATRSNPKKKR--KSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGG 287
                    .::.:.|.:....||.|.:|  ..|..|:..|...|||.|..|||:|..||.::|..
Human   158 RPASSTAFPREESMLPLLTQDSNSKARRGILRRAVFSEDQRKALEKMFQKQKYISKTDRKKLAIN 222

  Fly   288 LGLSNAQVITWFQNRRAKLKRDMEELKKDVQCEKIPDQSADP-NRSHHNHP-------HYHQQH 343
            |||..:||..||||||.|.:...|:.....:|.:......|| :||....|       ...|||
Human   223 LGLKESQVKIWFQNRRMKWRNSKEKEVLSNRCIQEVGLQEDPLSRSALGFPSPCPSIWDVPQQH 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 43/144 (30%)
Homeobox 254..307 CDD:278475 26/52 (50%)
DBX2NP_001004329.2 Homeobox 189..242 CDD:278475 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..318 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.