DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and slou

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster


Alignment Length:444 Identity:91/444 - (20%)
Similarity:152/444 - (34%) Gaps:140/444 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PSPANSDVS----------------VGSPSPPPLRS-------------LNMKRLRLLRSPISLE 41
            ||||.|.:|                :..|..||..|             ::::|::|:.:..:..
  Fly   251 PSPATSPLSPPTSPAMHSDQQMSPPIAPPQNPPHSSQPPQQQQVAAPSDMDLERIKLVAAVAART 315

  Fly    42 HDRQKSSPVRVKSFSIADILGRGHEEDRVEKKPERIAIPNALPGVPAPLALINERLQIPLVPNCP 106
            .....:|.:...|.|:::               ..|:|.|:..|.|:...|.:...:|.|.....
  Fly   316 TQASSTSALASASNSVSN---------------ASISISNSSSGSPSGRDLSDYGFRIQLGGLAA 365

  Fly   107 PPAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDGSSE------- 164
            ..||                 |....||:.....|::....::.::.....|.|||..       
  Fly   366 AAAA-----------------AAATSRQIAAATYARSDTSEELNVDGNDEDSNDGSHSTPSVCPV 413

  Fly   165 ---RSQRSSS----SNGSTECCSPTQAEKVEKR---SQEDRMEVPKKSPEEQPKG---------- 209
               ||..||:    |:.||...|...|  ..||   |.|:.::..|.:..:.|.|          
  Fly   414 DLTRSVNSSAAANPSSASTSASSDRDA--ATKRLAFSVENILDPNKFTGNKLPSGPFGHPRQWSY 476

  Fly   210 -----ASKSSGDTPLDALFQLSTKNFDEE---QDPATLNIFATRSNPK----------------- 249
                 ..:...|...:.:......:.|::   .|.:.::..::.::.|                 
  Fly   477 ERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDIDDPSSETDSKKGGSRNGDGKSGGGGGG 541

  Fly   250 --KKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEE 312
              |.|::|||||.:|:..||.:|...:|||..:|..:|..|.|:..||..||||||.|.|:....
  Fly   542 GSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPG 606

  Fly   313 LKKDVQCEKIPDQSAD-------------------PNRSHHNHP--HYHQQHQH 345
            :  ||....||.....                   |....:.||  .:|..|.|
  Fly   607 M--DVNSPTIPPPGGGSFGPGAYASGLLYSHAVPYPPYGPYFHPLGAHHLSHSH 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 39/181 (22%)
Homeobox 254..307 CDD:278475 25/52 (48%)
slouNP_001262808.1 Homeobox 549..601 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.