DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and ventx1.2

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_988861.1 Gene:ventx1.2 / 394455 XenbaseID:XB-GENE-920868 Length:262 Species:Xenopus tropicalis


Alignment Length:333 Identity:82/333 - (24%)
Similarity:112/333 - (33%) Gaps:122/333 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KSFSIADILGRGHEE-----DRVEKKPERIAIPNALPGVPAPLALINERLQIPLVPNCPPPAALH 112
            :.|||..||.|..||     |.|..:|.       :|..|.|||......:||            
 Frog     4 QGFSIDLILARNREEAPDGKDSVSSRPH-------IPCAPQPLAPTKYAKEIP------------ 49

  Fly   113 TFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLN----PAIIASEDGSSERSQRSSSSN 173
                        :|.....|.::.. ||..::..|....:    ||:..|...|.|.|...|..:
 Frog    50 ------------RRKDGQEQGEITS-FQCSSEEARNRQFSNPSLPALHRSSGSSDEFSPAGSEDD 101

  Fly   174 GSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPAT 238
            |:         |...:.|||:..|...|||:..                                
 Frog   102 GT---------ESSGRNSQENDTEHRSKSPKSD-------------------------------- 125

  Fly   239 LNIFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRR 303
                       .:|:.|||||.|||..||:.|..|:||..::|.::|..|.||..||.|||||||
 Frog   126 -----------LQRRLRTAFTPQQITRLEQAFNKQRYLGASERKKLATSLQLSEIQVKTWFQNRR 179

  Fly   304 AKLKRDMEELKKDVQCEKIPDQSADPNRSHH------------------NHPHYHQQH------- 343
            .||||.::    |.|...:|.....|....:                  .||....||       
 Frog   180 MKLKRQIQ----DQQPSMVPPPVCYPQTFSYYPGGLPVPLNSGSFYQPPAHPFQAPQHSFIPQPL 240

  Fly   344 QHYAHMQS 351
            .|:..|.:
 Frog   241 HHHMRMSA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 37/125 (30%)
Homeobox 254..307 CDD:278475 29/52 (56%)
ventx1.2NP_988861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..129 33/196 (17%)
Homeobox 131..183 CDD:278475 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.