DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and NKX1-2

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001139812.1 Gene:NKX1-2 / 390010 HGNCID:31652 Length:310 Species:Homo sapiens


Alignment Length:286 Identity:70/286 - (24%)
Similarity:106/286 - (37%) Gaps:98/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KSSPVRVK-SFSIADILGRGHEEDRVEKKPERIAIPNALPGV-PAPLALINERLQIPLVPNCPPP 108
            |::|...| |||:.|||           .|::.. ..|||.| |||.                  
Human    10 KAAPSHHKISFSVLDIL-----------DPQKFT-RAALPAVRPAPR------------------ 44

  Fly   109 AALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDGSSERSQR----- 168
                                 :.::.|.|                 :.|.:|.||....|     
Human    45 ---------------------EARKSLAE-----------------VEAGKDASSRDPVRQLETP 71

  Fly   169 SSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSG-----DTPLDALFQLSTK 228
            .::..|:.: .||.:..:.|   :|:..|.|:: |..:.:.|....|     |.|..||  .|.:
Human    72 DAAGPGAGQ-ASPLEGSEAE---EEEDAEDPRR-PRLRERAARLLPGLARSPDAPAGAL--ASGE 129

  Fly   229 NFDE---------EQDPATLNIFATRSNPK--KKRKSRTAFTNQQIFELEKRFLYQKYLSPADRD 282
            ..::         ...|.:......|..|.  |.|::|||||.:|:..||.:|...:|||..:|.
Human   130 PCEDGGGGPVRSPPGSPGSPRPRRRRLEPNCAKPRRARTAFTYEQLVALENKFRATRYLSVCERL 194

  Fly   283 EIAGGLGLSNAQVITWFQNRRAKLKR 308
            .:|..|.|:..||..||||||.|.|:
Human   195 NLALSLSLTETQVKIWFQNRRTKWKK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 38/119 (32%)
Homeobox 254..307 CDD:278475 25/52 (48%)
NKX1-2NP_001139812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..165 32/191 (17%)
Homeobox 167..219 CDD:278475 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..260 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.