DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and CG34031

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:195 Identity:53/195 - (27%)
Similarity:79/195 - (40%) Gaps:60/195 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LRQMTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGA 210
            |...:::..:..||..||:.|....::|.::...|...|...   :||               |.
  Fly    28 LGAFSIDSILSTSEAHSSQNSLPKDNTNVTSSDISKLYAFSF---TQE---------------GN 74

  Fly   211 SKSSGDTPLDALFQLSTKNFDEEQ----------DPATLNIFATR------------SNPKKK-- 251
            :|    |||        .|||..|          |.:|::.|..|            :|.::|  
  Fly    75 NK----TPL--------TNFDLCQGHPRRLPITFDGSTVSRFVWRTESILPSYITNSTNLQEKQL 127

  Fly   252 ------RKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDM 310
                  ||.|.|::..|:..||..|...||||.:.|.|::..|.|:..||.|||||||.|.|:.:
  Fly   128 RKRFTDRKPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNRRTKWKKQL 192

  Fly   311  310
              Fly   193  192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 42/135 (31%)
Homeobox 254..307 CDD:278475 24/52 (46%)
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.