DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Noto

DIOPT Version :10

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001007473.1 Gene:Noto / 384452 MGIID:3053002 Length:240 Species:Mus musculus


Alignment Length:79 Identity:29/79 - (36%)
Similarity:41/79 - (51%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 RKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKD 316
            ::.||.|..||:.||||.|..|..|...:|.::|..|.|:..||..||||||.|.::..:.....
Mouse   150 KRVRTTFNLQQLQELEKVFAKQHNLVGKERAQLAARLHLTENQVRIWFQNRRVKYQKQQKLKLPS 214

  Fly   317 VQCEKIPDQSADPN 330
            ....:.|..|:|.|
Mouse   215 SSVMEEPSSSSDGN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 29/79 (37%)
Homeodomain 252..308 CDD:459649 25/55 (45%)
NotoNP_001007473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Homeodomain 150..206 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..240 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.