DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Dbx

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_647677.2 Gene:Dbx / 38254 FlyBaseID:FBgn0261723 Length:741 Species:Drosophila melanogaster


Alignment Length:393 Identity:85/393 - (21%)
Similarity:137/393 - (34%) Gaps:130/393 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SSPVRVKSFSIADILGRGHEEDRVEK---KPERI----------------------AIPNALPGV 86
            |.|  :..||::.|||...|..||..   :|:.|                      ..|::.|. 
  Fly   149 SKP--ILKFSVSAILGDTREGVRVRNEFMQPQHIWPYLQQNFMQQHSHQYQQHHQQQQPHSHPQ- 210

  Fly    87 PAPLALINERLQIPLVPNCPPPAALHTFLSPALLHSYEQRLAW-DYQRQLQEHFQAQAQLLRQMT 150
                   ::.|.:|...:..|.:..|....|...|::....|: .:|....:|.|.|..:.:|..
  Fly   211 -------HQPLAVPGHQHSHPHSHHHHHHHPGAGHAHFPHPAFLTHQLPPHQHHQQQQHVQQQHP 268

  Fly   151 LN-----PAIIASEDGS----SERSQRSSSSNGS---------------TECCSPTQAEKVEKRS 191
            .|     .|..:|..||    |:.:..:|::||:               ....:|.:.....:|.
  Fly   269 GNSCQPQTASSSSSPGSTISDSDNNHGASTANGNGSGTGNSGQDARPHELANSNPDEDSSASRRL 333

  Fly   192 QEDRMEV---------------------PKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQD 235
            .:|:.:.                     |...|...|...:|.....|...|             
  Fly   334 TQDKQQQQQLLGAGGTGGGGGGGHGHGHPTPPPPPPPPVIAKPMPSRPTPFL------------- 385

  Fly   236 PATLN---------------------IF------------ATRSNPKKKRKSRTAFTNQQIFELE 267
            |.|||                     :|            :||..|::....|..|::.|...||
  Fly   386 PHTLNHPHLHSLLAHCRNPYMSVGAQVFPLPPGQGFPWAHSTRGKPRRGMMRRAVFSDSQRKGLE 450

  Fly   268 KRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKDVQCEKIPDQSADPNRS 332
            |||..|||:|..||.::|..|||.::||..||||||.|.:...|  ::.:......||:. ||::
  Fly   451 KRFQQQKYISKPDRKKLAERLGLKDSQVKIWFQNRRMKWRNSKE--RELLASGGSRDQTL-PNKN 512

  Fly   333 HHN 335
            :.|
  Fly   513 NPN 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 44/158 (28%)
Homeobox 254..307 CDD:278475 27/52 (52%)
DbxNP_647677.2 Homeobox 437..490 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.