DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and ved

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_898897.1 Gene:ved / 368201 ZFINID:ZDB-GENE-030813-1 Length:278 Species:Danio rerio


Alignment Length:200 Identity:60/200 - (30%)
Similarity:84/200 - (42%) Gaps:54/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 SEDGSSERSQRSSSSN------GSTECCSPTQAEK-------VEKRSQEDRME--------VPKK 201
            |:..||.|.::.:||.      ||....:....||       .||..||..||        ..|.
Zfish    11 SQSSSSVRDEQQTSSTSTDSLPGSYSRWTSPHMEKHMEEKYTEEKYLQEKSMEKFMHEKYTEEKH 75

  Fly   202 SPEEQPKGA-----SKSSGDTPLDALFQLSTKNFDEE----------------QDPATLNIFATR 245
            .||:..:|.     :..||       |..||:  |||                :.||.....|..
Zfish    76 MPEKYTEGKRIQKHTHESG-------FSSSTE--DEELSGCESEGSRSEGSGSRSPAAPGSVAPA 131

  Fly   246 S---NPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLK 307
            |   :|...|:.||||:::||..||:.|....||...|:.|:...|.|::.|:..||||||.|||
Zfish   132 SGSGSPSSGRRPRTAFSSEQISSLERVFKRNAYLGAQDKAELCRTLKLTDKQIRNWFQNRRMKLK 196

  Fly   308 RDMEE 312
            |.:::
Zfish   197 RTVQD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 41/130 (32%)
Homeobox 254..307 CDD:278475 23/52 (44%)
vedNP_898897.1 Homeobox 145..196 CDD:278475 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.