Sequence 1: | NP_001262805.1 | Gene: | lbl / 42541 | FlyBaseID: | FBgn0008651 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_898897.1 | Gene: | ved / 368201 | ZFINID: | ZDB-GENE-030813-1 | Length: | 278 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 60/200 - (30%) |
---|---|---|---|
Similarity: | 84/200 - (42%) | Gaps: | 54/200 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 158 SEDGSSERSQRSSSSN------GSTECCSPTQAEK-------VEKRSQEDRME--------VPKK 201
Fly 202 SPEEQPKGA-----SKSSGDTPLDALFQLSTKNFDEE----------------QDPATLNIFATR 245
Fly 246 S---NPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLK 307
Fly 308 RDMEE 312 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lbl | NP_001262805.1 | COG5576 | 206..332 | CDD:227863 | 41/130 (32%) |
Homeobox | 254..307 | CDD:278475 | 23/52 (44%) | ||
ved | NP_898897.1 | Homeobox | 145..196 | CDD:278475 | 22/50 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |