DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and Hoxc9

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001094377.1 Gene:Hoxc9 / 368178 RGDID:1595784 Length:260 Species:Rattus norvegicus


Alignment Length:281 Identity:70/281 - (24%)
Similarity:110/281 - (39%) Gaps:47/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VKSFSIADILGRGHEEDRVEKKPERIAIPNALPGVPAPLALINERLQIPLVPNCPPPAALHTFLS 116
            :.::.:..::...:|:....:.|    ...|.|....|..|:.:....|.....|.||...|..:
  Rat     7 ISNYYVDSLISHDNEDLLASRFP----ATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWA 67

  Fly   117 P------ALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNP-----AIIASEDGSSERSQRSS 170
            |      .:.|.|..          |.|..|..:.:|.. |.|     :..:...|....:.:..
  Rat    68 PVPSQSSVVYHPYGP----------QPHLGADTRYMRTW-LEPLSGAVSFPSFPAGGRHYALKPD 121

  Fly   171 SSNGSTECCSPTQAEKVEKRSQEDRM-----EVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNF 230
            :..|....|.|.     :.||..|.|     |:..::|:..|...:        |||  ..:|:.
  Rat   122 AYPGRRADCGPG-----DGRSYPDYMYGSPGELRDRAPQTLPSPEA--------DAL--AGSKHK 171

  Fly   231 DEEQDPATLNIFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQV 295
            :|:.|....|..|...:.:..||.|..:|..|..||||.||:..||:...|.|:|..|.|:..||
  Rat   172 EEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQV 236

  Fly   296 ITWFQNRRAKLKRDMEELKKD 316
            ..||||||.|:|: |.:.|.|
  Rat   237 KIWFQNRRMKMKK-MNKEKTD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 40/111 (36%)
Homeobox 254..307 CDD:278475 25/52 (48%)
Hoxc9NP_001094377.1 Hox9_act 1..179 CDD:398350 37/201 (18%)
HOX 192..241 CDD:197696 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.