DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and H2.0

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster


Alignment Length:435 Identity:100/435 - (22%)
Similarity:154/435 - (35%) Gaps:109/435 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RTPSPANSD-----------VSVGSPSPPPLRSLNMKRL-----RLLRSPISLEHDRQKSSPVRV 52
            :.|.|.|.|           .::.|.||....|....:|     |||.|.....| ||.||....
  Fly    34 KCPDPVNVDHELPTKESCASTTIVSTSPTSATSTTKVKLSFSVDRLLGSEPEESH-RQSSSSPST 97

  Fly    53 KS---------------FSIADILGR--GHEEDRVEKKPER------IAIPNALPGV-------- 86
            ||               ||.|:...|  ||........|..      :.:....||.        
  Fly    98 KSCCDGSILACCSFPHCFSQANAESRRFGHATLPPTFTPTSSHTYPFVGLDKLFPGPYMDYKSVL 162

  Fly    87 -PAPLALINERLQIPLVPNCPPPAALHTFLSPALL--HSYEQRLAWDYQRQLQEHFQAQAQLLRQ 148
             |.|:     |......|..|      |..:.|||  |.::::     |.|...|.|...:.|.|
  Fly   163 RPTPI-----RAAEHAAPTYP------TLATNALLRFHQHQKQ-----QHQQHHHHQHHPKHLHQ 211

  Fly   149 MTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKS 213
            ....|     ...|:..|...:..:..|......|.::...::.:..:::...||.......|::
  Fly   212 QHKPP-----PHNSTTASALLAPLHSLTSLQLTQQQQRFLGKTPQQLLDIAPTSPAAAAAATSQN 271

  Fly   214 ------SGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRK-SRTAFTNQQIFELEKRFL 271
                  .|:...:|                     :..||.|:||. ||..|:|.|...||.:|.
  Fly   272 GAHGHGGGNGQGNA---------------------SAGSNGKRKRSWSRAVFSNLQRKGLEIQFQ 315

  Fly   272 YQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELK--KDVQCEKIPDQSADPNRSHH 334
            .|||::..||.::|..|.|::|||..||||||.|.:...|.||  ::.|...:|:.......|..
  Fly   316 QQKYITKPDRRKLAARLNLTDAQVKVWFQNRRMKWRHTRENLKSGQEKQPSAVPESGGVFKTSTP 380

  Fly   335 NHPHYHQQHQHYAHMQSIGSDRDMDKDRCREKEKDKDKEELRMLK 379
            :.....|:...|:      ||.....|...:.::| |..|:.:::
  Fly   381 SGDGTPQEALDYS------SDSCSSVDLSEQADED-DNIEINVVE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 39/134 (29%)
Homeobox 254..307 CDD:278475 26/52 (50%)
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.