DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and B-H1

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523387.1 Gene:B-H1 / 32724 FlyBaseID:FBgn0011758 Length:544 Species:Drosophila melanogaster


Alignment Length:323 Identity:75/323 - (23%)
Similarity:118/323 - (36%) Gaps:110/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PNCPPPAALHTFLSPALLHSYEQ-------------RLAWDYQRQLQEHFQAQAQLLRQMTLNPA 154
            |...||...||. ..||:|.:.:             .:| .|...:|:|:.|.|          |
  Fly   150 PQPHPPTHPHTH-PHALMHPHGKLGHFPPTAGGNGLNVA-QYAAAMQQHYAAAA----------A 202

  Fly   155 IIASEDGSSERSQRSSSSNGSTECCSPT--------------------------QAEKVEKRSQE 193
            ..|:.:.::..:..::::..:.....|.                          :.|..:..:.:
  Fly   203 AAAARNNAAAAAAAAAAAAAAGVAAPPVDGGVDGGVGLAPPAGGDLDDSSDYHEENEDCDSGNMD 267

  Fly   194 DRMEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRKSRTAF 258
            |.........::.  |.|..||.|                .|.:.|:        ||:||:||||
  Fly   268 DHSVCSNGGKDDD--GNSVKSGST----------------SDMSGLS--------KKQRKARTAF 306

  Fly   259 TNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRD-------MEELKKD 316
            |:.|:..|||.|..|||||..:|.|:|..|.||:.||.||:||||.|.||.       :.|....
  Fly   307 TDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQTAVGLELLAEAGNF 371

  Fly   317 VQCEKI----PDQSADP-----NRSHHNHPH-----YHQQ------------HQHYAHMQSIG 353
            ...:::    |...|.|     ..:|...||     |::|            :..||.:.|:|
  Fly   372 AAFQRLYGGSPYLGAWPYAAAAGAAHGATPHTNIDIYYRQAAAAAAMQKPLPYNLYAGVPSVG 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 47/141 (33%)
Homeobox 254..307 CDD:278475 30/52 (58%)
B-H1NP_523387.1 Homeobox 303..355 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.