DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HOXD9

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_055028.3 Gene:HOXD9 / 3235 HGNCID:5140 Length:352 Species:Homo sapiens


Alignment Length:314 Identity:77/314 - (24%)
Similarity:101/314 - (32%) Gaps:118/314 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSPPPLRSLNMKRLRLLRSPISLEHDRQKSSPVRVKSFSIADILGRGHEEDRVEKKPERIAIPNA 82
            |||.|                        |.|...:.:.|               |||..|.|  
Human   145 PSPGP------------------------SGPANGRHYGI---------------KPETRAAP-- 168

  Fly    83 LPGVPAPLALINERLQIPLVPNCPPPAALHTFLSPALLHSYEQRLAWDYQRQLQ----------E 137
                                  .|..||..|..|...|.|..:|......|:.|          .
Human   169 ----------------------APATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCNS 211

  Fly   138 HFQAQAQLLRQMTLNPAIIASEDGSSERSQRSSSSNGSTECCSPTQAEKVEKRSQEDRMEVPKKS 202
            ..|.:|......|...|.|.:..|:...|:.|:.|:.....||..:.||  :.||          
Human   212 FLQEKAAAATGGTGPGAGIGAATGTGGSSEPSACSDHPIPGCSLKEEEK--QHSQ---------- 264

  Fly   203 PEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIFATRSNPKKKRKSRTAFTNQQIFELE 267
            |::|                 ||...|      ||...|.|     :..||.|..:|..|..|||
Human   265 PQQQ-----------------QLDPNN------PAANWIHA-----RSTRKKRCPYTKYQTLELE 301

  Fly   268 KRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEELKKDVQCEK 321
            |.||:..||:...|.|:|..|.|:..||..||||||.|:|:..:|     :|.|
Human   302 KEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKE-----KCPK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 39/116 (34%)
Homeobox 254..307 CDD:278475 25/52 (48%)
HOXD9NP_055028.3 Hox9_act 11..>164 CDD:282473 9/57 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..208 22/125 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..276 16/81 (20%)
HOX 285..337 CDD:197696 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.