DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HOXC10

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_059105.2 Gene:HOXC10 / 3226 HGNCID:5122 Length:342 Species:Homo sapiens


Alignment Length:331 Identity:84/331 - (25%)
Similarity:125/331 - (37%) Gaps:84/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PSPANSDVSVGSPS------PPPLRSLNM----KRLRLLRSPISLEHDRQKSS---PVRVKSFSI 57
            ||.:..|.. .|||      |..|..|:.    |....|..|:.    |..||   |..||..::
Human    51 PSLSKRDEG-SSPSLALNTYPSYLSQLDSWGDPKAAYRLEQPVG----RPLSSCSYPPSVKEENV 110

  Fly    58 ADILGRGHEEDRVEKKPERIAIPNALPGVPAPLALINERLQIPL---------------VPNCPP 107
            ..:..   .|.|.:..||.     ||...|.|.:.:.|. ::|:               .|:|  
Human   111 CCMYS---AEKRAKSGPEA-----ALYSHPLPESCLGEH-EVPVPSYYRASPSYSALDKTPHC-- 164

  Fly   108 PAALHTFLSPALLHSYEQRLAWDYQRQLQEHFQAQAQLLRQMTLNPAIIASEDGSSERSQRSSSS 172
             :..:.|.:|     :|||.:          ...:|:.|....|...:...|...|: ||..|.:
Human   165 -SGANDFEAP-----FEQRAS----------LNPRAEHLESPQLGGKVSFPETPKSD-SQTPSPN 212

  Fly   173 NGSTECCSPTQAEKVEKRSQEDRMEVPKKSPEEQPKGASKSSGDTPLDALFQLSTKNFDEEQDPA 237
            ...|                |..:..||.||.|..|..:|::..:|       .|.:.:.:::..
Human   213 EIKT----------------EQSLAGPKGSPSESEKERAKAADSSP-------DTSDNEAKEEIK 254

  Fly   238 TLNIFATRSNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNR 302
            ..|........|..||.|..:|..|..||||.||:..||:...|.||:..:.|::.||..|||||
Human   255 AENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNR 319

  Fly   303 RAKLKR 308
            |.|||:
Human   320 RMKLKK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 34/103 (33%)
Homeobox 254..307 CDD:278475 24/52 (46%)
HOXC10NP_059105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..271 21/107 (20%)
Homeobox 271..324 CDD:306543 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.