DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and HOXC5

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:143 Identity:44/143 - (30%)
Similarity:66/143 - (46%) Gaps:32/143 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 AEKVEKRSQEDRMEVPKKSPEE-----QPKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIF- 242
            ::|..:.:.|:|.:...:..||     ||.|.|                      |.||...|: 
Human   100 SQKAARPALEERAKSSGEIKEEQAQTGQPAGLS----------------------QPPAPPQIYP 142

  Fly   243 -ATR---SNPKKKRKSRTAFTNQQIFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRR 303
             .|:   |:....::|||::|..|..||||.|.:.:||:...|.|||..|.|:..|:..||||||
Human   143 WMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRR 207

  Fly   304 AKLKRDMEELKKD 316
            .|.|:|.:...|:
Human   208 MKWKKDSKMKSKE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 39/116 (34%)
Homeobox 254..307 CDD:278475 26/52 (50%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 12/62 (19%)
Antp-type hexapeptide 140..145 1/4 (25%)
Homeobox 158..211 CDD:306543 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.