DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lbl and TLX2

DIOPT Version :9

Sequence 1:NP_001262805.1 Gene:lbl / 42541 FlyBaseID:FBgn0008651 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_057254.1 Gene:TLX2 / 3196 HGNCID:5057 Length:284 Species:Homo sapiens


Alignment Length:173 Identity:55/173 - (31%)
Similarity:83/173 - (47%) Gaps:25/173 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 PKGASKSSGDTPLDALFQLSTKNFDEEQDPATLNIFA-TR--------SNPKKKRKSRTAFTNQQ 262
            |.|...:.|...|...:..|.:.|.:::..|.|:.|: ||        ..|.|::|.||:|:..|
Human   104 PSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQ 168

  Fly   263 IFELEKRFLYQKYLSPADRDEIAGGLGLSNAQVITWFQNRRAKLKRDMEE--------------- 312
            :.|||:|||.||||:.|:|..:|..|.:::|||.|||||||.|.:|...|               
Human   169 VLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLH 233

  Fly   313 LKKDVQCEKI-PDQSADPNRSHHNHPHYHQQHQHYAHMQSIGS 354
            |::|.....: |....||...|::.....|..|.:|....:.|
Human   234 LQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVAS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lblNP_001262805.1 COG5576 206..332 CDD:227863 50/149 (34%)
Homeobox 254..307 CDD:278475 29/52 (56%)
TLX2NP_057254.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..106 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..166 9/26 (35%)
Homeobox 160..213 CDD:278475 29/52 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.